General Information

  • ID:  hor006246
  • Uniprot ID:  P97297
  • Protein name:  Proadrenomedullin N-20 terminal peptide
  • Gene name:  Adm
  • Organism:  Mus musculus (Mouse)
  • Family:  Adrenomedullin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031700 adrenomedullin receptor binding
  • GO BP:  GO:0001570 vasculogenesis; GO:0001666 response to hypoxia; GO:0001843 neural tube closure; GO:0002026 regulation of the force of heart contraction; GO:0002031 G protein-coupled receptor internalization; GO:0003073 regulation of systemic arterial blood pressure; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007507 heart development; GO:0007565 female pregnancy; GO:0008209 androgen metabolic process; GO:0008283 cell population proliferation; GO:0008284 positive regulation of cell population proliferation; GO:0008285 negative regulation of cell population proliferation; GO:0010033 response to organic substance; GO:0010460 positive regulation of heart rate; GO:0019731 antibacterial humoral response; GO:0019933 cAMP-mediated signaling; GO:0031100 animal organ regeneration; GO:0031102 neuron projection regeneration; GO:0031623 receptor internalization; GO:0032496 response to lipopolysaccharide; GO:0032868 response to insulin; GO:0035809 regulation of urine volume; GO:0042475 odontogenesis of dentin-containing tooth; GO:0042594 response to starvation; GO:0043065 positive regulation of apoptotic process; GO:0043116 negative regulation of vascular permeability; GO:0045766 positive regulation of angiogenesis; GO:0045906 negative regulation of vasoconstriction; GO:0048589 developmental growth; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:0051384 response to glucocorticoid; GO:0060670 branching involved in labyrinthine layer morphogenesis; GO:0060712 spongiotrophoblast layer development; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0097084 vascular associated smooth muscle cell development; GO:1990410 adrenomedullin receptor signaling pathw
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  AGPDTPSQFRKKWNKWALSR
  • Length:  20
  • Propeptide:  MKLVSITLMLLGSLAFLGADTAGPDTPSQFRKKWNKWALSRGKRELQASSSYPTGLADETTVPTQTLDPFLDEQNTTGPLQASNQSEAHIRVKRYRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMAPRNKISPQGYGRRRRRSLLEVLRSRTVESSQEQTHTAPGPWAHISRLFRI
  • Signal peptide:  MKLVSITLMLLGSLAFLGADT
  • Modification:  T20 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  AM and PAMP are potent hypotensive and vasodilatator agents.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P97297-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006246_AF2.pdbhor006246_ESM.pdb

Physical Information

Mass: 271277 Formula: C108H165N33O28
Absent amino acids: CEHIMVY Common amino acids: K
pI: 11.75 Basic residues: 5
Polar residues: 5 Hydrophobic residues: 6
Hydrophobicity: -143.5 Boman Index: -5964
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 29.5
Instability Index: 3383 Extinction Coefficient cystines: 11000
Absorbance 280nm: 578.95

Literature

  • PubMed ID:  8938454
  • Title:  Genomic organization, expression, and chromosomal mapping of the mouse adrenomedullin gene.
  • PubMed ID:  9808778
  • Title:  Expression of adrenomedullin, a hypotensive peptide, in the trophoblast giant cells at the embryo implantation site in mouse.
  • PubMed ID:  16141072
  • Title:  The transcriptional landscape of the mammalian genome.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).